Anti-SNTA1 Ver mas grande

Anti-SNTA1 Antibody 25ul

AN-HPA067154-25ul

Producto nuevo

Anti-SNTA1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name SNTA1
Gene Description syntrophin alpha 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Immunogen GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Product Group Polyclonal Antibodies
Alternative Names LQT12, SNT1, TACIP1
Categoria Polyclonal
Host RABBIT
UniProt ID Q13424
HTS Code 3002150000
Gene ID 6640
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human SNTA1, Gene description: syntrophin alpha 1, Alternative Gene Names: LQT12, SNT1, TACIP1, Validated applications: IHC, Uniprot ID: Q13424, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image