Anti-MCM8
  • Anti-MCM8

Anti-MCM8 Antibody 25ul

Ref: AN-HPA066433-25ul
Anti-MCM8

Información del producto

Polyclonal Antibody against Human MCM8, Gene description: minichromosome maintenance 8 homologous recombination repair factor, Alternative Gene Names: C20orf154, dJ967N21.5, MGC119522, MGC119523, MGC12866, MGC4816, REC, Validated applications: ICC, Uniprot ID: Q9UJA3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MCM8
Gene Description minichromosome maintenance 8 homologous recombination repair factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKA
Immunogen GDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKA
Product Group Polyclonal Antibodies
Alternative Names C20orf154, dJ967N21.5, MGC119522, MGC119523, MGC12866, MGC4816, REC
Categoria Polyclonal
Host RABBIT
UniProt ID Q9UJA3
HTS Code 3002150000
Gene ID 84515
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MCM8 Antibody 25ul

Anti-MCM8 Antibody 25ul