Anti-SPECC1
  • Anti-SPECC1

Anti-SPECC1 Antibody 100ul

Ref: AN-HPA061073-100ul
Anti-SPECC1

Información del producto

Polyclonal Antibody against Human SPECC1, Gene description: sperm antigen with calponin homology and coiled-coil domains 1, Alternative Gene Names: CYTSB, FLJ36955, HCMOGT-1, NSP, Validated applications: ICC, WB, Uniprot ID: Q5M775, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPECC1
Gene Description sperm antigen with calponin homology and coiled-coil domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLNKPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRT
Immunogen MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLNKPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRT
Product Group Polyclonal Antibodies
Alternative Names CYTSB, FLJ36955, HCMOGT-1, NSP
Categoria Polyclonal
Host RABBIT
UniProt ID Q5M775
HTS Code 3002150000
Gene ID 92521
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPECC1 Antibody 100ul

Anti-SPECC1 Antibody 100ul