Ver mas grande
Anti-ST8SIA2 Antibody 25ul
AN-HPA057819-25ul
Producto nuevo
Anti-ST8SIA2
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 25ul |
| Gene Name | ST8SIA2 |
| Gene Description | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC |
| Sequence | EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI |
| Immunogen | EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI |
| Product Group | Polyclonal Antibodies |
| Alternative Names | HsT19690, SIAT8B, ST8SIA-II, STX |
| Categoria | Polyclonal |
| Host | RABBIT |
| UniProt ID | Q92186 |
| HTS Code | 3002150000 |
| Gene ID | 8128 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | ICC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human ST8SIA2, Gene description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, Alternative Gene Names: HsT19690, SIAT8B, ST8SIA-II, STX, Validated applications: ICC, Uniprot ID: Q92186, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF