Anti-EFCAB12 Ver mas grande

Anti-EFCAB12 Antibody 25ul

AN-HPA057532-25ul

Producto nuevo

Anti-EFCAB12

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name EFCAB12
Gene Description EF-hand calcium binding domain 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLKVKRSSGLQQTHPNSFWPGHL
Immunogen DKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLKVKRSSGLQQTHPNSFWPGHL
Product Group Polyclonal Antibodies
Alternative Names C3orf25
Categoria Polyclonal
Host RABBIT
UniProt ID Q6NXP0
HTS Code 3002150000
Gene ID 90288
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human EFCAB12, Gene description: EF-hand calcium binding domain 12, Alternative Gene Names: C3orf25, Validated applications: ICC, Uniprot ID: Q6NXP0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image