Anti-CACNA1B Ver mas grande

Anti-CACNA1B Antibody 25ul

AN-HPA022919-25ul

Producto nuevo

Anti-CACNA1B

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name CACNA1B
Gene Description calcium voltage-gated channel subunit alpha1 B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Immunogen ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Product Group Polyclonal Antibodies
Alternative Names CACNL1A5, CACNN, Cav2.2
Categoria Polyclonal
Host RABBIT
UniProt ID Q00975
HTS Code 3002150000
Gene ID 774
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human CACNA1B, Gene description: calcium voltage-gated channel subunit alpha1 B, Alternative Gene Names: CACNL1A5, CACNN, Cav2.2, Validated applications: ICC, Uniprot ID: Q00975, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image