Anti-FCGR2A Ver mas grande

Anti-FCGR2A Antibody 25ul

AN-HPA010776-25ul

Producto nuevo

Anti-FCGR2A

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name FCGR2A
Gene Description Fc fragment of IgG receptor IIa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Immunogen RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Product Group Polyclonal Antibodies
Alternative Names CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2
Categoria Polyclonal
Host RABBIT
UniProt ID P12318
HTS Code 3002150000
Gene ID 2212
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human FCGR2A, Gene description: Fc fragment of IgG receptor IIa, Alternative Gene Names: CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2, Validated applications: ICC, Uniprot ID: P12318, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image