KCNAB3,AKR6A9,KCNA3B
  • KCNAB3,AKR6A9,KCNA3B

Anti-KCNAB3 Antibody 25ul

Ref: AN-HPA077993-25ul
Anti-KCNAB3

Información del producto

Polyclonal Antibody against Human KCNAB3, Gene description: potassium channel, voltage gated subfamily A regulatory beta subunit 3, Alternative Gene Names: AKR6A9, KCNA3B, Validated applications: ICC, Uniprot ID: O43448, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KCNAB3
Gene Description potassium channel, voltage gated subfamily A regulatory beta subunit 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ
Immunogen CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AKR6A9, KCNA3B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43448
HTS Code 3002150000
Gene ID 9196
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KCNAB3 Antibody 25ul

Anti-KCNAB3 Antibody 25ul