RPL36A,L36A,RPL44
  • RPL36A,L36A,RPL44

Anti-RPL36A Antibody 25ul

Ref: AN-HPA077586-25ul
Anti-RPL36A

Información del producto

Polyclonal Antibody against Human RPL36A, Gene description: ribosomal protein L36a, Alternative Gene Names: L36A, RPL44, Validated applications: ICC, Uniprot ID: P83881, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPL36A
Gene Description ribosomal protein L36a
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG
Immunogen MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L36A, RPL44
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P83881
HTS Code 3002150000
Gene ID 6173
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPL36A Antibody 25ul

Anti-RPL36A Antibody 25ul