DNAJC5B,CSP-beta
  • DNAJC5B,CSP-beta

Anti-DNAJC5B Antibody 25ul

Ref: AN-HPA077389-25ul
Anti-DNAJC5B

Información del producto

Polyclonal Antibody against Human DNAJC5B, Gene description: DnaJ heat shock protein family (Hsp40) member C5 beta, Alternative Gene Names: CSP-beta, MGC26226, Validated applications: ICC, Uniprot ID: Q9UF47, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAJC5B
Gene Description DnaJ heat shock protein family (Hsp40) member C5 beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
Immunogen MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CSP-beta, MGC26226
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UF47
HTS Code 3002150000
Gene ID 85479
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAJC5B Antibody 25ul

Anti-DNAJC5B Antibody 25ul