PCDHA11,CNR7,CNRN7
  • PCDHA11,CNR7,CNRN7

Anti-PCDHA11 Antibody 100ul

Ref: AN-HPA077160-100ul
Anti-PCDHA11

Información del producto

Polyclonal Antibody against Human PCDHA11, Gene description: protocadherin alpha 11, Alternative Gene Names: CNR7, CNRN7, CNRS7, CRNR7, PCDH-ALPHA11, Validated applications: ICC, Uniprot ID: Q9Y5I1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCDHA11
Gene Description protocadherin alpha 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK
Immunogen VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CNR7, CNRN7, CNRS7, CRNR7, PCDH-ALPHA11
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5I1
HTS Code 3002150000
Gene ID 56138
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCDHA11 Antibody 100ul

Anti-PCDHA11 Antibody 100ul