LMTK3,KIAA1883,LMR3
  • LMTK3,KIAA1883,LMR3

Anti-LMTK3 Antibody 100ul

Ref: AN-HPA077070-100ul
Anti-LMTK3

Información del producto

Polyclonal Antibody against Human LMTK3, Gene description: lemur tyrosine kinase 3, Alternative Gene Names: KIAA1883, LMR3, PPP1R101, TYKLM3, Validated applications: IHC, Uniprot ID: Q96Q04, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LMTK3
Gene Description lemur tyrosine kinase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC
Sequence CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP
Immunogen CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1883, LMR3, PPP1R101, TYKLM3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96Q04
HTS Code 3002150000
Gene ID 114783
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LMTK3 Antibody 100ul

Anti-LMTK3 Antibody 100ul