HEYL,bHLHb33,HESR3
  • HEYL,bHLHb33,HESR3

Anti-HEYL Antibody 25ul

Ref: AN-HPA076960-25ul
Anti-HEYL

Información del producto

Polyclonal Antibody against Human HEYL, Gene description: hes related family bHLH transcription factor with YRPW motif-like, Alternative Gene Names: bHLHb33, HESR3, HEY3, Validated applications: IHC, Uniprot ID: Q9NQ87, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HEYL
Gene Description hes related family bHLH transcription factor with YRPW motif-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
Immunogen MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHb33, HESR3, HEY3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQ87
HTS Code 3002150000
Gene ID 26508
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HEYL Antibody 25ul

Anti-HEYL Antibody 25ul