DEGS1,DEGS-1,Des-1
  • DEGS1,DEGS-1,Des-1

Anti-DEGS1 Antibody 25ul

Ref: AN-HPA076422-25ul
Anti-DEGS1

Información del producto

Polyclonal Antibody against Human DEGS1, Gene description: delta(4)-desaturase, sphingolipid 1, Alternative Gene Names: DEGS-1, Des-1, DES1, FADS7, MLD, Validated applications: ICC, Uniprot ID: O15121, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DEGS1
Gene Description delta(4)-desaturase, sphingolipid 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Immunogen YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEGS-1, Des-1, DES1, FADS7, MLD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15121
HTS Code 3002150000
Gene ID 8560
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DEGS1 Antibody 25ul

Anti-DEGS1 Antibody 25ul