MERTK,c-Eyk,mer
  • MERTK,c-Eyk,mer

Anti-MERTK Antibody 100ul

Ref: AN-HPA075622-100ul
Anti-MERTK

Información del producto

Polyclonal Antibody against Human MERTK, Gene description: MER proto-oncogene, tyrosine kinase, Alternative Gene Names: c-Eyk, mer, RP38, Tyro12, Validated applications: ICC, Uniprot ID: Q12866, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MERTK
Gene Description MER proto-oncogene, tyrosine kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
Immunogen PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-Eyk, mer, RP38, Tyro12
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12866
HTS Code 3002150000
Gene ID 10461
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MERTK Antibody 100ul

Anti-MERTK Antibody 100ul