PPP1R9A,FLJ20068
  • PPP1R9A,FLJ20068

Anti-PPP1R9A Antibody 100ul

Ref: AN-HPA075591-100ul
Anti-PPP1R9A

Información del producto

Polyclonal Antibody against Human PPP1R9A, Gene description: protein phosphatase 1 regulatory subunit 9A, Alternative Gene Names: FLJ20068, KIAA1222, Neurabin-I, Validated applications: ICC, Uniprot ID: Q9ULJ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP1R9A
Gene Description protein phosphatase 1 regulatory subunit 9A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS
Immunogen KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20068, KIAA1222, Neurabin-I
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULJ8
HTS Code 3002150000
Gene ID 55607
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP1R9A Antibody 100ul

Anti-PPP1R9A Antibody 100ul