SERF1A,4F5,FAM2A
  • SERF1A,4F5,FAM2A

Anti-SERF1A Antibody 25ul

Ref: AN-HPA075271-25ul
Anti-SERF1A

Información del producto

Polyclonal Antibody against Human SERF1A, Gene description: small EDRK-rich factor 1A (telomeric), Alternative Gene Names: 4F5, FAM2A, H4F5, SERF1, SMAM1, Validated applications: ICC, Uniprot ID: O75920, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SERF1A
Gene Description small EDRK-rich factor 1A (telomeric)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR
Immunogen SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4F5, FAM2A, H4F5, SERF1, SMAM1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75920
HTS Code 3002150000
Gene ID 8293
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SERF1A Antibody 25ul

Anti-SERF1A Antibody 25ul