ITGA4,CD49D
  • ITGA4,CD49D

Anti-ITGA4 Antibody 25ul

Ref: AN-HPA074961-25ul
Anti-ITGA4

Información del producto

Polyclonal Antibody against Human ITGA4, Gene description: integrin subunit alpha 4, Alternative Gene Names: CD49D, Validated applications: ICC, Uniprot ID: P13612, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ITGA4
Gene Description integrin subunit alpha 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR
Immunogen RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD49D
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13612
HTS Code 3002150000
Gene ID 3676
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ITGA4 Antibody 25ul

Anti-ITGA4 Antibody 25ul