HEY2,bHLHb32,HERP1
  • HEY2,bHLHb32,HERP1

Anti-HEY2 Antibody 25ul

Ref: AN-HPA074851-25ul
Anti-HEY2

Información del producto

Polyclonal Antibody against Human HEY2, Gene description: hes-related family bHLH transcription factor with YRPW motif 2, Alternative Gene Names: bHLHb32, HERP1, HESR2, Validated applications: ICC, Uniprot ID: Q9UBP5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HEY2
Gene Description hes-related family bHLH transcription factor with YRPW motif 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK
Immunogen PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHb32, HERP1, HESR2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBP5
HTS Code 3002150000
Gene ID 23493
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HEY2 Antibody 25ul

Anti-HEY2 Antibody 25ul