SLC6A4,5-HTT,HTT
  • SLC6A4,5-HTT,HTT

Anti-SLC6A4 Antibody 25ul

Ref: AN-HPA074728-25ul
Anti-SLC6A4

Información del producto

Polyclonal Antibody against Human SLC6A4, Gene description: solute carrier family 6 (neurotransmitter transporter), member 4, Alternative Gene Names: 5-HTT, HTT, OCD1, SERT1, Validated applications: ICC, Uniprot ID: P31645, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC6A4
Gene Description solute carrier family 6 (neurotransmitter transporter), member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI
Immunogen KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 5-HTT, HTT, OCD1, SERT1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P31645
HTS Code 3002150000
Gene ID 6532
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC6A4 Antibody 25ul

Anti-SLC6A4 Antibody 25ul