GVQW1,bA205M20.5
  • GVQW1,bA205M20.5

Anti-GVQW1 Antibody 100ul

Ref: AN-HPA074576-100ul
Anti-GVQW1

Información del producto

Polyclonal Antibody against Human GVQW1, Gene description: GVQW motif containing 1, Alternative Gene Names: bA205M20.5, TIGD1L2, Validated applications: ICC, Uniprot ID: Q8N7I0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GVQW1
Gene Description GVQW motif containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS
Immunogen STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA205M20.5, TIGD1L2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N7I0
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GVQW1 Antibody 100ul

Anti-GVQW1 Antibody 100ul