NOD1,CARD4,CLR7.1
  • NOD1,CARD4,CLR7.1

Anti-NOD1 Antibody 25ul

Ref: AN-HPA074367-25ul
Anti-NOD1

Información del producto

Polyclonal Antibody against Human NOD1, Gene description: nucleotide-binding oligomerization domain containing 1, Alternative Gene Names: CARD4, CLR7.1, NLRC1, Validated applications: ICC, Uniprot ID: Q9Y239, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NOD1
Gene Description nucleotide-binding oligomerization domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
Immunogen NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CARD4, CLR7.1, NLRC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y239
HTS Code 3002150000
Gene ID 10392
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NOD1 Antibody 25ul

Anti-NOD1 Antibody 25ul