CUZD1,ERG-1,UO-44
  • CUZD1,ERG-1,UO-44

Anti-CUZD1 Antibody 25ul

Ref: AN-HPA074117-25ul
Anti-CUZD1

Información del producto

Polyclonal Antibody against Human CUZD1, Gene description: CUB and zona pellucida-like domains 1, Alternative Gene Names: ERG-1, UO-44, Validated applications: ICC, Uniprot ID: Q86UP6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CUZD1
Gene Description CUB and zona pellucida-like domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SNGNNLQLKDPTCRPKLSNVVEFSVPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQIIVKCEM
Immunogen SNGNNLQLKDPTCRPKLSNVVEFSVPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQIIVKCEM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERG-1, UO-44
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UP6
HTS Code 3002150000
Gene ID 50624
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CUZD1 Antibody 25ul

Anti-CUZD1 Antibody 25ul