SOCS1,Cish1,JAB
  • SOCS1,Cish1,JAB

Anti-SOCS1 Antibody 100ul

Ref: AN-HPA074108-100ul
Anti-SOCS1

Información del producto

Polyclonal Antibody against Human SOCS1, Gene description: suppressor of cytokine signaling 1, Alternative Gene Names: Cish1, JAB, SOCS-1, SSI-1, TIP3, Validated applications: ICC, Uniprot ID: O15524, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SOCS1
Gene Description suppressor of cytokine signaling 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Immunogen LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cish1, JAB, SOCS-1, SSI-1, TIP3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15524
HTS Code 3002150000
Gene ID 8651
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SOCS1 Antibody 100ul

Anti-SOCS1 Antibody 100ul