FEZF1,ZNF312B
  • FEZF1,ZNF312B

Anti-FEZF1 Antibody 25ul

Ref: AN-HPA073693-25ul
Anti-FEZF1

Información del producto

Polyclonal Antibody against Human FEZF1, Gene description: FEZ family zinc finger 1, Alternative Gene Names: ZNF312B, Validated applications: IHC, Uniprot ID: A0PJY2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FEZF1
Gene Description FEZ family zinc finger 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
Immunogen YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZNF312B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A0PJY2
HTS Code 3002150000
Gene ID 389549
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FEZF1 Antibody 25ul

Anti-FEZF1 Antibody 25ul