CDK11A,CDC2L2
  • CDK11A,CDC2L2

Anti-CDK11A Antibody 25ul

Ref: AN-HPA073626-25ul
Anti-CDK11A

Información del producto

Polyclonal Antibody against Human CDK11A, Gene description: cyclin-dependent kinase 11A, Alternative Gene Names: CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, p58GTA, PITSLRE, Validated applications: ICC, Uniprot ID: Q9UQ88, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDK11A
Gene Description cyclin-dependent kinase 11A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL
Immunogen MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, p58GTA, PITSLRE
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UQ88
HTS Code 3002150000
Gene ID 728642
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDK11A Antibody 25ul

Anti-CDK11A Antibody 25ul