YIPF5,FinGER5,SMAP-5
  • YIPF5,FinGER5,SMAP-5

Anti-YIPF5 Antibody 25ul

Ref: AN-HPA073622-25ul
Anti-YIPF5

Información del producto

Polyclonal Antibody against Human YIPF5, Gene description: Yip1 domain family, member 5, Alternative Gene Names: FinGER5, SMAP-5, Validated applications: ICC, IHC, WB, Uniprot ID: Q969M3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name YIPF5
Gene Description Yip1 domain family, member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD
Immunogen SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FinGER5, SMAP-5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969M3
HTS Code 3002150000
Gene ID 81555
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-YIPF5 Antibody 25ul

Anti-YIPF5 Antibody 25ul