UNC13D,Munc13-4
  • UNC13D,Munc13-4

Anti-UNC13D Antibody 100ul

Ref: AN-HPA073525-100ul
Anti-UNC13D

Información del producto

Polyclonal Antibody against Human UNC13D, Gene description: unc-13 homolog D (C. elegans), Alternative Gene Names: Munc13-4, Validated applications: ICC, Uniprot ID: Q70J99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UNC13D
Gene Description unc-13 homolog D (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV
Immunogen TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Munc13-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q70J99
HTS Code 3002150000
Gene ID 201294
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UNC13D Antibody 100ul

Anti-UNC13D Antibody 100ul