PCDH10,KIAA1400
  • PCDH10,KIAA1400

Anti-PCDH10 Antibody 100ul

Ref: AN-HPA073462-100ul
Anti-PCDH10

Información del producto

Polyclonal Antibody against Human PCDH10, Gene description: protocadherin 10, Alternative Gene Names: KIAA1400, OL-PCDH, Validated applications: ICC, Uniprot ID: Q9P2E7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCDH10
Gene Description protocadherin 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Immunogen MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1400, OL-PCDH
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2E7
HTS Code 3002150000
Gene ID 57575
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCDH10 Antibody 100ul

Anti-PCDH10 Antibody 100ul