KIF5A,D12S1889
  • KIF5A,D12S1889

Anti-KIF5A Antibody 25ul

Ref: AN-HPA073448-25ul
Anti-KIF5A

Información del producto

Polyclonal Antibody against Human KIF5A, Gene description: kinesin family member 5A, Alternative Gene Names: D12S1889, MY050, NKHC, SPG10, Validated applications: ICC, Uniprot ID: Q12840, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KIF5A
Gene Description kinesin family member 5A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT
Immunogen RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D12S1889, MY050, NKHC, SPG10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12840
HTS Code 3002150000
Gene ID 3798
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KIF5A Antibody 25ul

Anti-KIF5A Antibody 25ul