AGPAT1,LPAAT-alpha
  • AGPAT1,LPAAT-alpha

Anti-AGPAT1 Antibody 100ul

Ref: AN-HPA073355-100ul
Anti-AGPAT1

Información del producto

Polyclonal Antibody against Human AGPAT1, Gene description: 1-acylglycerol-3-phosphate O-acyltransferase 1, Alternative Gene Names: LPAAT-alpha, Validated applications: IHC, WB, Uniprot ID: Q99943, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AGPAT1
Gene Description 1-acylglycerol-3-phosphate O-acyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Immunogen GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LPAAT-alpha
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99943
HTS Code 3002150000
Gene ID 10554
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AGPAT1 Antibody 100ul

Anti-AGPAT1 Antibody 100ul