NDUFA9,CI-39k
  • NDUFA9,CI-39k

Anti-NDUFA9 Antibody 100ul

Ref: AN-HPA073212-100ul
Anti-NDUFA9

Información del producto

Polyclonal Antibody against Human NDUFA9, Gene description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, Alternative Gene Names: CI-39k, NDUFS2L, SDR22E1, Validated applications: ICC, WB, Uniprot ID: Q16795, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFA9
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL
Immunogen AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CI-39k, NDUFS2L, SDR22E1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16795
HTS Code 3002150000
Gene ID 4704
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFA9 Antibody 100ul

Anti-NDUFA9 Antibody 100ul