FLI1,EWSR2,SIC-1
  • FLI1,EWSR2,SIC-1

Anti-FLI1 Antibody 100ul

Ref: AN-HPA073099-100ul
Anti-FLI1

Información del producto

Polyclonal Antibody against Human FLI1, Gene description: Fli-1 proto-oncogene, ETS transcription factor, Alternative Gene Names: EWSR2, SIC-1, Validated applications: ICC, Uniprot ID: Q01543, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FLI1
Gene Description Fli-1 proto-oncogene, ETS transcription factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT
Immunogen SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EWSR2, SIC-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01543
HTS Code 3002150000
Gene ID 2313
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FLI1 Antibody 100ul

Anti-FLI1 Antibody 100ul