C9orf3,AOPEP,AP-O
  • C9orf3,AOPEP,AP-O

Anti-C9orf3 Antibody 25ul

Ref: AN-HPA072729-25ul
Anti-C9orf3

Información del producto

Polyclonal Antibody against Human C9orf3, Gene description: chromosome 9 open reading frame 3, Alternative Gene Names: AOPEP, AP-O, APO, C90RF3, FLJ14675, Validated applications: ICC, Uniprot ID: Q8N6M6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C9orf3
Gene Description chromosome 9 open reading frame 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPT
Immunogen LFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AOPEP, AP-O, APO, C90RF3, FLJ14675
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N6M6
HTS Code 3002150000
Gene ID 84909
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C9orf3 Antibody 25ul

Anti-C9orf3 Antibody 25ul