PLCH2,KIAA0450
  • PLCH2,KIAA0450

Anti-PLCH2 Antibody 25ul

Ref: AN-HPA072705-25ul
Anti-PLCH2

Información del producto

Polyclonal Antibody against Human PLCH2, Gene description: phospholipase C eta 2, Alternative Gene Names: KIAA0450, PLC-eta2, PLCeta2, PLCL4, RP3-395M20.1, Validated applications: IHC, Uniprot ID: O75038, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLCH2
Gene Description phospholipase C eta 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR
Immunogen AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0450, PLC-eta2, PLCeta2, PLCL4, RP3-395M20.1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75038
HTS Code 3002150000
Gene ID 9651
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLCH2 Antibody 25ul

Anti-PLCH2 Antibody 25ul