SCARB1,CD36L1,CLA-1
  • SCARB1,CD36L1,CLA-1

Anti-SCARB1 Antibody 25ul

Ref: AN-HPA072449-25ul
Anti-SCARB1

Información del producto

Polyclonal Antibody against Human SCARB1, Gene description: scavenger receptor class B member 1, Alternative Gene Names: CD36L1, CLA-1, CLA1, SR-BI, SRB1, Validated applications: IHC, Uniprot ID: Q8WTV0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SCARB1
Gene Description scavenger receptor class B member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL
Immunogen CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD36L1, CLA-1, CLA1, SR-BI, SRB1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WTV0
HTS Code 3002150000
Gene ID 949
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SCARB1 Antibody 25ul

Anti-SCARB1 Antibody 25ul