DPYSL5,CRAM,CRMP-5
  • DPYSL5,CRAM,CRMP-5

Anti-DPYSL5 Antibody 100ul

Ref: AN-HPA072387-100ul
Anti-DPYSL5

Información del producto

Polyclonal Antibody against Human DPYSL5, Gene description: dihydropyrimidinase-like 5, Alternative Gene Names: CRAM, CRMP-5, CRMP5, Ulip6, Validated applications: ICC, WB, Uniprot ID: Q9BPU6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DPYSL5
Gene Description dihydropyrimidinase-like 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence CPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDH
Immunogen CPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRAM, CRMP-5, CRMP5, Ulip6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BPU6
HTS Code 3002150000
Gene ID 56896
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DPYSL5 Antibody 100ul

Anti-DPYSL5 Antibody 100ul