MAP3K12,DLK,MEKK12
  • MAP3K12,DLK,MEKK12

Anti-MAP3K12 Antibody 100ul

Ref: AN-HPA071996-100ul
Anti-MAP3K12

Información del producto

Polyclonal Antibody against Human MAP3K12, Gene description: mitogen-activated protein kinase kinase kinase 12, Alternative Gene Names: DLK, MEKK12, MUK, ZPK, ZPKP1, Validated applications: ICC, Uniprot ID: Q12852, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAP3K12
Gene Description mitogen-activated protein kinase kinase kinase 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL
Immunogen LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DLK, MEKK12, MUK, ZPK, ZPKP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12852
HTS Code 3002150000
Gene ID 7786
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAP3K12 Antibody 100ul

Anti-MAP3K12 Antibody 100ul