MRPS27,KIAA0264
  • MRPS27,KIAA0264

Anti-MRPS27 Antibody 25ul

Ref: AN-HPA071751-25ul
Anti-MRPS27

Información del producto

Polyclonal Antibody against Human MRPS27, Gene description: mitochondrial ribosomal protein S27, Alternative Gene Names: KIAA0264, Validated applications: IHC, WB, Uniprot ID: Q92552, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPS27
Gene Description mitochondrial ribosomal protein S27
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence FSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGAS
Immunogen FSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0264
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92552
HTS Code 3002150000
Gene ID 23107
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS27 Antibody 25ul

Anti-MRPS27 Antibody 25ul