HBZ,HBZ-T1,HBZ1
  • HBZ,HBZ-T1,HBZ1

Anti-HBZ Antibody 100ul

Ref: AN-HPA071726-100ul
Anti-HBZ

Información del producto

Polyclonal Antibody against Human HBZ, Gene description: hemoglobin subunit zeta, Alternative Gene Names: HBZ-T1, HBZ1, Validated applications: IHC, Uniprot ID: P02008, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HBZ
Gene Description hemoglobin subunit zeta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY
Immunogen TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HBZ-T1, HBZ1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P02008
HTS Code 3002150000
Gene ID 3050
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HBZ Antibody 100ul

Anti-HBZ Antibody 100ul