NAT10,FLJ10774
  • NAT10,FLJ10774

Anti-NAT10 Antibody 25ul

Ref: AN-HPA071628-25ul
Anti-NAT10

Información del producto

Polyclonal Antibody against Human NAT10, Gene description: N-acetyltransferase 10 (GCN5-related), Alternative Gene Names: FLJ10774, FLJ12179, hALP, KIAA1709, NET43, Validated applications: ICC, Uniprot ID: Q9H0A0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NAT10
Gene Description N-acetyltransferase 10 (GCN5-related)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP
Immunogen RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10774, FLJ12179, hALP, KIAA1709, NET43
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0A0
HTS Code 3002150000
Gene ID 55226
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NAT10 Antibody 25ul

Anti-NAT10 Antibody 25ul