ZNF616,MGC45556
  • ZNF616,MGC45556

Anti-ZNF616 Antibody 25ul

Ref: AN-HPA071539-25ul
Anti-ZNF616

Información del producto

Polyclonal Antibody against Human ZNF616, Gene description: zinc finger protein 616, Alternative Gene Names: MGC45556, Validated applications: IHC, Uniprot ID: Q08AN1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF616
Gene Description zinc finger protein 616
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCN
Immunogen NQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC45556
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08AN1
HTS Code 3002150000
Gene ID 90317
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF616 Antibody 25ul

Anti-ZNF616 Antibody 25ul