CTAG2,CAMEL,CT6.2a
  • CTAG2,CAMEL,CT6.2a

Anti-CTAG2 Antibody 25ul

Ref: AN-HPA071467-25ul
Anti-CTAG2

Información del producto

Polyclonal Antibody against Human CTAG2, Gene description: cancer/testis antigen 2, Alternative Gene Names: CAMEL, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE-1a, LAGE-1b, LAGE1, MGC138724, MGC3803, Validated applications: IHC, Uniprot ID: O75638, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CTAG2
Gene Description cancer/testis antigen 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL
Immunogen AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAMEL, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE-1a, LAGE-1b, LAGE1, MGC138724, MGC3803
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75638
HTS Code 3002150000
Gene ID 30848
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CTAG2 Antibody 25ul

Anti-CTAG2 Antibody 25ul