ELF2,EU32,NERF
  • ELF2,EU32,NERF

Anti-ELF2 Antibody 100ul

Ref: AN-HPA071166-100ul
Anti-ELF2

Información del producto

Polyclonal Antibody against Human ELF2, Gene description: E74-like factor 2 (ets domain transcription factor), Alternative Gene Names: EU32, NERF, NERF-1A, NERF-1B, NERF-2, Validated applications: ICC, IHC, WB, Uniprot ID: Q15723, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ELF2
Gene Description E74-like factor 2 (ets domain transcription factor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
Immunogen TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EU32, NERF, NERF-1A, NERF-1B, NERF-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15723
HTS Code 3002150000
Gene ID 1998
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ELF2 Antibody 100ul

Anti-ELF2 Antibody 100ul