FRRS1L,C9orf4,CG-6
  • FRRS1L,C9orf4,CG-6

Anti-FRRS1L Antibody 100ul

Ref: AN-HPA071086-100ul
Anti-FRRS1L

Información del producto

Polyclonal Antibody against Human FRRS1L, Gene description: ferric-chelate reductase 1-like, Alternative Gene Names: C9orf4, CG-6, Validated applications: IHC, Uniprot ID: Q9P0K9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FRRS1L
Gene Description ferric-chelate reductase 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC
Immunogen RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf4, CG-6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0K9
HTS Code 3002150000
Gene ID 23732
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FRRS1L Antibody 100ul

Anti-FRRS1L Antibody 100ul