GDF15,MIC-1,MIC1
  • GDF15,MIC-1,MIC1

Anti-GDF15 Antibody 100ul

Ref: AN-HPA070957-100ul
Anti-GDF15

Información del producto

Polyclonal Antibody against Human GDF15, Gene description: growth differentiation factor 15, Alternative Gene Names: MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB, Validated applications: ICC, Uniprot ID: Q99988, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GDF15
Gene Description growth differentiation factor 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
Immunogen EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99988
HTS Code 3002150000
Gene ID 9518
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GDF15 Antibody 100ul

Anti-GDF15 Antibody 100ul