MTMR9,C8orf9
  • MTMR9,C8orf9

Anti-MTMR9 Antibody 25ul

Ref: AN-HPA070944-25ul
Anti-MTMR9

Información del producto

Polyclonal Antibody against Human MTMR9, Gene description: myotubularin related protein 9, Alternative Gene Names: C8orf9, DKFZp434K171, LIP-STYX, MTMR8, Validated applications: ICC, WB, Uniprot ID: Q96QG7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MTMR9
Gene Description myotubularin related protein 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence LSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKV
Immunogen LSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C8orf9, DKFZp434K171, LIP-STYX, MTMR8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96QG7
HTS Code 3002150000
Gene ID 66036
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MTMR9 Antibody 25ul

Anti-MTMR9 Antibody 25ul