DDX54,APR-5,DP97
  • DDX54,APR-5,DP97

Anti-DDX54 Antibody 25ul

Ref: AN-HPA070786-25ul
Anti-DDX54

Información del producto

Polyclonal Antibody against Human DDX54, Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, Alternative Gene Names: APR-5, DP97, MGC2835, Validated applications: ICC, Uniprot ID: Q8TDD1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DDX54
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDEEDSGLQSTLEASLELRGLARVADNAQQQYV
Immunogen TAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDEEDSGLQSTLEASLELRGLARVADNAQQQYV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APR-5, DP97, MGC2835
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDD1
HTS Code 3002150000
Gene ID 79039
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DDX54 Antibody 25ul

Anti-DDX54 Antibody 25ul