TJP2,DFNA51,X104
  • TJP2,DFNA51,X104

Anti-TJP2 Antibody 25ul

Ref: AN-HPA070714-25ul
Anti-TJP2

Información del producto

Polyclonal Antibody against Human TJP2, Gene description: tight junction protein 2, Alternative Gene Names: DFNA51, X104, ZO-2, ZO2, Validated applications: ICC, WB, Uniprot ID: Q9UDY2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TJP2
Gene Description tight junction protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence QHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPT
Immunogen QHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DFNA51, X104, ZO-2, ZO2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UDY2
HTS Code 3002150000
Gene ID 9414
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TJP2 Antibody 25ul

Anti-TJP2 Antibody 25ul