RBM25,fSAP94,NET52
  • RBM25,fSAP94,NET52

Anti-RBM25 Antibody 25ul

Ref: AN-HPA070713-25ul
Anti-RBM25

Información del producto

Polyclonal Antibody against Human RBM25, Gene description: RNA binding motif protein 25, Alternative Gene Names: fSAP94, NET52, RNPC7, S164, Snu71, Validated applications: ICC, Uniprot ID: P49756, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM25
Gene Description RNA binding motif protein 25
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW
Immunogen FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names fSAP94, NET52, RNPC7, S164, Snu71
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49756
HTS Code 3002150000
Gene ID 58517
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBM25 Antibody 25ul

Anti-RBM25 Antibody 25ul